DPCstruct | MC4176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 311 ± 39 aa |
| Standard deviation of domain lengths | 39.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 13.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A443KCN3 | 13-312 | LLKNIVLVMPMFSVWSGSGKLEPSDFTNVDADDLPPETVAKLGLKRLINRDALSPFTRLRARADRLCEEYGTRFMGGFAIPEDYAPV… |
| A0A2M7MZA6 | 48-340 | TIPSVVDNIQSLYSQGALVSVQHKVKPMSVPIPASLFGQQGEQQIGTVRYKQQFRIELFADEATAKEVEEQRKRVTKLVQLFSYSFG… |
| A0A2E3EMC0 | 3-293 | None |
| A0A371SKK3 | 5-294 | None |
| A0A662ZKW0 | 31-326 | None |
| A0A4P5T550 | 51-350 | None |
| A0A0L6W3X8 | 4-428 | None |
| A0A5N9VUF7 | 17-255 | None |
| A0A256Z1U5 | 2-349 | None |
| A0A420VDQ2 | 22-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.