DPCstruct | MC41757
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 112 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U9BFZ8 | 78-187 | MKCFLDFKSGGALCHILAAAYKFKSDQGWRRFDFQNPSRMDRNVEMFMTIEKSLVQNNCLTRPVIYLSPDIEPKLLGKLKDIIKRHQ… |
| A0A1S4EKR2 | 74-179 | PLTRLPMKCFLDFKPGGALCHILSTIYKYKSEQGWRRFDLQSPSRMDRNVEMFMNVEKALIQNKCLVMPNVFIRSDVEKSVQSKVKE… |
| A0A6P7GRZ5 | 68-184 | None |
| A0A151P4S9 | 5-114 | None |
| Q550R6 | 98-208 | None |
| A0A183K8Q2 | 67-201 | None |
| A0A1I8I236 | 72-179 | None |
| A0A818DEV7 | 71-181 | None |
| A0A183BCA2 | 1-113 | None |
| H9JL48 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.