DPCstruct | MC41756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 138 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.87 |
| Pfam Score | 91.13 |
| Assigned Pfam label(s) | CL0081- PF05033 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5MHR5 | 7-145 | YKSPCGLTLRSMSEIERYLFSVHCDFIFLEMFCLDPYVLVDRRFQPQKPSYFISDITEGKEDVPLSCVNEIDVTPPPSVAYSKERIP… |
| T1K8E0 | 225-370 | EVSYVAPCGRRLRNIEELDKYLSITNCSLSIDYFTFEVYVELYNESGNSRIRCNWLNNDITVGRESKIISAINSCDNVEFPSDFNYI… |
| A0A2Y9NGA1 | 173-319 | None |
| A0A3Q0KPQ6 | 598-741 | None |
| A0A3Q0KQ18 | 248-391 | None |
| A0A2J8VSC4 | 176-319 | None |
| A0A183NFE4 | 2-130 | None |
| A0A6J3EK70 | 191-337 | None |
| A0A819LK65 | 667-786 | None |
| A0A669D436 | 68-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.