DPCstruct | MC41753
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 178 ± 34 aa |
| Standard deviation of domain lengths | 34.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07904 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7YJ50 | 101-271 | LGDATNDSINDSSVFEEEEETPKQSYIRWTTEAETHLLCKVIQFRPMGPNGNANMEQLVVEMSRIKEGDEFTYYADVLNKVDYAVYQ… |
| W5M8Y5 | 1-155 | MGEAEAVPADEKQADSGSSPVEESVIWSQEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVSSKVIWDHLGTMYDMQALH… |
| V2X3Y9 | 4-207 | None |
| A0A044SX11 | 24-168 | None |
| S7Q4M4 | 3-169 | None |
| A0A512UEA8 | 2-199 | None |
| H0EFJ6 | 26-191 | None |
| A0A2A2KR07 | 1-198 | None |
| A0A6J0UHR4 | 1-145 | None |
| A0A3M7RYS0 | 4-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.