DPCstruct | MC41752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 179 ± 32 aa |
| Standard deviation of domain lengths | 31.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0020- CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5M2A3 | 2-196 | VKSLVQNPFLYLGSYVRSLVSSIMYCILEPLAASINPLNDHWTLRDYAALLLSHIFWTHGDLVSGLYHQILLSLQKVLSDPVRPLCS… |
| A0A3P7Y8E1 | 118-268 | RMIRSIAVNKSVKLDGVLHEFLPSLMSCMLGRVLCTRPDSDNHWALRDFAGKTLITIIKDHGTKETKRRSFRAVKRIFDEPSSSYSM… |
| A0A7R9P4H7 | 259-409 | None |
| A0A0A9Y0P3 | 31-256 | None |
| A0A178C7N7 | 626-788 | None |
| A0A7S3F9E4 | 6-163 | None |
| A0A3R7IA57 | 678-840 | None |
| A0A1Y1LHA3 | 103-325 | None |
| A0A842YZ10 | 69-233 | None |
| A0A1R0GNQ7 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.