DPCstruct | MC4175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 150 ± 23 aa |
| Standard deviation of domain lengths | 22.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1JJI5 | 1-110 | MREENLKKLSYNSQRCYLRGVLNDRYDPDERQITISNTGNKTQDYIYTQAENLPVYLGTMWLEPEFNYAGSKVDFLVNVPPELMNTK… |
| A0A1G5K4N2 | 6-164 | LNFSKLVELLVPTFLRKNRTLAFLKVLTAPMQIIAAENLYRMQHDGRTMYLEKMLNEHYGVSSYNHQDHENTKLIYIDTVSTGDKLY… |
| A0A173V6V2 | 6-180 | None |
| A0A4S2B2Z6 | 5-157 | None |
| A0A2E2FN51 | 1-171 | None |
| A0A060R8N6 | 4-145 | None |
| A0A5J4SP58 | 3-156 | None |
| A0A1Q3ZHN2 | 4-127 | None |
| A0A349E020 | 1-170 | None |
| A0A5C7URW3 | 25-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.