DPCstruct | MC41741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 160 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C2JEP5 | 5-163 | TPTPEKAITAPWDSSAHNWSAPNQYCLSVLRHQLKHAAPDHSPETRPGLMTEAGEGMMRMLAPRDGTETLLCIQAIQAHNNASECLH… |
| A0A0W0WW57 | 21-153 | AKEKFNRHIIDENAIATNNIRAEKFDMDKAKQKSSDALIALDVNGGLQSMLAAQMLSIHEFQQRTMTYANAIDSLELKKYYTNTAVK… |
| A0A3C1NCG0 | 1-198 | None |
| A0A1E4GC21 | 30-208 | None |
| A0A4Z0NFH8 | 54-187 | None |
| K1YMC1 | 25-190 | None |
| A0A7Y0BSI6 | 78-230 | None |
| A0A258Z9I1 | 49-213 | None |
| A0A2E3H6A7 | 6-131 | None |
| A0A7Y4YHG0 | 62-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.