DPCstruct | MC4174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 19.32 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6IIV7 | 17-126 | MESQRSIQRKYAKLKLEPAEPNQINCYACTSCPEITKTIDIHKGTSPFVTSCFVCGAPARSSFYNDTVPDQAIDMEWHMPTLNETVK… |
| A0A1G5K1G9 | 20-121 | TNKYYKVDLTNRVNCYTCRHPKCGHITKTKDIAPGVTPMFYECEKCHFQAVSSMYNDIAPDQEPTFVWDRPTLSETMKFRKKPTLLD… |
| E5CG81 | 12-106 | None |
| A0A7T7YTV7 | 6-133 | None |
| A0A1E4GWX2 | 1-105 | None |
| A0A0Q6Z3I2 | 6-101 | None |
| A0A3N2KH16 | 166-263 | None |
| A0A0F9RLZ6 | 86-199 | None |
| A0A840EHI0 | 4-116 | None |
| A0A1V5C144 | 142-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.