DPCstruct | MC41736
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 99 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X2S004 | 62-175 | ARTCYDHLAGEIAVGVLASMQKARWLRRKDSELIATRLGEHQLRALGVDFDSARDERRVFARSCADLTQRRPHLGGALGAHMLNLYI… |
| A0A1C2I688 | 108-221 | ARSCYDHLAGQLGVAMTDALVRKGYLIENERDYRVTPSGESWFCDLGVNTQPDPRSRRAFTRKCLDWSERRYHLGGVLGAAMLETFL… |
| A0A3D1V7K6 | 19-119 | None |
| A0A2P4RB46 | 5-72 | None |
| A0A4P6UE74 | 89-168 | None |
| A0A5C6S8S6 | 4-70 | None |
| A0A6L3C596 | 5-110 | None |
| G0AA76 | 26-120 | None |
| D6BC85 | 7-94 | None |
| A0A7Y5QMB5 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.