DPCstruct | MC41735
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 81 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F3HI29 | 14-100 | KPASYEPKEKVSGEWQGEEVSFNASFSGHRFTAEEVAQLLAGEVISFQAINKKGKAYTAKGQLAKKRYKGKNFVGFDLILDKKKARK |
| E1R0I3 | 101-179 | THAEGIWARTGTKVRFKRSFGTHTFSEGEVTALLADEYVGFTATSRSGGQYEATGRLEPQSFEAGGGRVVNFIGFKPDF |
| A0A415G9E7 | 602-679 | None |
| A0A517D886 | 613-694 | None |
| R9J5V7 | 2-87 | None |
| A0A542GBS0 | 23-101 | None |
| A0A1H9ACI6 | 123-201 | None |
| A0A0K2RTV2 | 66-144 | None |
| A0A4S2F2E8 | 2-82 | None |
| A0A3M0M8C2 | 145-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.