DPCstruct | MC41734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 338 ± 32 aa |
| Standard deviation of domain lengths | 32.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 20.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8H6K0 | 1-385 | MRAVILALILVLTLPLWSLAENQPAGKNYKKEFLERYDFFVTGKEKKEFKKLKTDEARDEFIANFWQIRDTNPDTPENEYKNLIDQR… |
| A0A7C5MDM0 | 8-285 | WKTDRGRIYITFGPPDEIESHPSGGTYERPFDEGGGVTSTYPFEIWRYRWIEGIGTDILIEFVDKSMSGEYRMTMDPSEKDALLMVP… |
| A0A7V4Y4Y6 | 1-375 | None |
| A0A7V5YQ14 | 2-329 | None |
| A0A7C5Z1X9 | 2-342 | None |
| A0A7R8B7Y8 | 1-334 | None |
| A0A7S7SMT5 | 2-299 | None |
| A0A7X5W460 | 23-377 | None |
| A0A523EAU7 | 1-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.