DPCstruct | MC41729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9UER0 | 8-142 | IKMLQEVMKGKRPKGWLYNNHCDFLLRHGNEFECQPLPEGIKKGTIKECYSNAFDLVLSEPDLIYVEGYANSIIPTNHAWCATPEGL… |
| A0A317UIP1 | 81-215 | VAEAKKMFPGMDERLFELKARLLDFAGEAVCLPPYEEDLENILEYGQFWLGYNAEMVKGEACQCHKNSARVWQKNKDKTVICTGYAL… |
| A0A7C8FEH1 | 2-119 | None |
| A0A2D9WQ52 | 59-184 | None |
| A0A415ZIH5 | 38-175 | None |
| A0A4S5CGZ6 | 28-148 | None |
| A0A840WT08 | 4-121 | None |
| A0A0Q4TMD8 | 5-114 | None |
| B1X2V4 | 45-194 | None |
| A0A2H1PXA8 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.