DPCstruct | MC41728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 128 |
|---|---|
| Mean domain length (aa) | 83 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9U6K2 | 76-154 | ENTGEASTADAGTATTLDDAILTQANDFWNGAKLIIVTTTDGFAPEGESSAVTDFDAGLDRLTFDALTAVVDAGDTYTI |
| A0A661UZY8 | 170-242 | LVTGACEGTPTTTVIQTNLAEITDDHYIGRIIVFTSGNALGEASNITDYAGGTGTVTVALMTTAPANLDTFTI |
| A0A661WSG4 | 164-251 | None |
| A0A1Y2H5U0 | 145-236 | None |
| A0A3B0CNL2 | 10-88 | None |
| A0A3C1F1C7 | 270-356 | None |
| A0A496SV41 | 357-450 | None |
| A0A0F9UQI1 | 86-170 | None |
| A0A1F5RYE3 | 946-1030 | None |
| A0A7W0NVL1 | 335-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.