DPCstruct | MC41723
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 130 ± 12 aa |
| Standard deviation of domain lengths | 12.13 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0408 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178A9T4 | 24-165 | TYFLIAGIGGINPEVTTVCSVTFARYAIQVALQYEFDPREIPANFSTGYVPQGSTTPDQYPGDIYGTEVFEVNDALRKLAVKFARTA… |
| A0A0L6WQC9 | 1-134 | MIAGIAGVNPMLATTGSVTFARYAVQVALQYEFDARDKPADFPTGYVPQGSFRPDQYPQELYGTEVFEVNEKLAVGYAKQATLNDTL… |
| A0A4Y9Y6C1 | 170-309 | None |
| A0A146H9F1 | 105-239 | None |
| A0A6L7XPF0 | 114-219 | None |
| A0A0L6WPQ9 | 1-137 | None |
| A0A2V9W6W3 | 119-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.