DPCstruct | MC41722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 165 ± 19 aa |
| Standard deviation of domain lengths | 18.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9NLJ8 | 1-155 | MAPTLSGQASTELDNAVGKYIRGIISTEPKWAAFVQARRELLTMREQLEQYRYVRSVQARFVGNATPADLQGAGGVTINKQQVIKAF… |
| A0A1B7NBW1 | 491-676 | SHTPNRARQSGHAGQESSSSSDEDGVRELSPPIPGRLADTVDERDDAVAKFIRSDIESDEGWPRCMSIISRGGPKRISDMLWCYDFI… |
| A0A0C2Z8P8 | 15-173 | None |
| A0A0D0ADB6 | 332-488 | None |
| J4HU21 | 1061-1234 | None |
| A0A146IA67 | 379-559 | None |
| A0A146H2D2 | 159-318 | None |
| A0A4Q2DCM1 | 1-190 | None |
| A0A4R0RWK8 | 545-710 | None |
| A0A165F6X0 | 338-520 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.