DPCstruct | MC41720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 14.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q9NE14 | 11-124 | ATLSGESPWASLHVLILPLFNREQLRVQIEDLNQLVKRHISTVVSMAPGKAVATLEHDTFELIATGMVTLNSKLSGVEDDKLVPRVV… |
| A0A165JP97 | 167-266 | SDRDSWGALHIHVLPLFNGDTLSRPIEELNALVKLHVNDVVVKRPSRAIATLENDLKDLVSNGMLTLNSKLANIDDEKLLPRIIELW… |
| A0A5J5EJP4 | 239-349 | None |
| E2LKX2 | 3-103 | None |
| A0A316YYQ9 | 380-495 | None |
| A0A1Y2I7H2 | 24-172 | None |
| V2XGZ1 | 9-142 | None |
| A0A0C3NU85 | 50-182 | None |
| A0A4S4KEG1 | 92-209 | None |
| V5EKJ9 | 538-644 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.