DPCstruct | MC4172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 636 ± 102 aa |
| Standard deviation of domain lengths | 101.91 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 14.26 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0268- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A256WB04 | 39-598 | LEQTGPQYIIGDVSWNGEIHACDDIHIEANATLKLNPGCILHMLEGKKIVVKREADLLVNNAIITNDGEGLWTGIEVWGDNLLPSNS… |
| A0A348P0U3 | 443-1082 | GRCTFSGVDLNFNAGSTVNMNQATLNTADNTTITGNITFPEYSELSVTIGTKLIVKSGSTLEFLPGSKIWLGQGSELVIDAGATLAF… |
| A0A3M1YSG8 | 603-1204 | None |
| A0A0Q0VSX3 | 479-1238 | None |
| I6Z755 | 92-672 | None |
| A0A2N5YRJ1 | 35-698 | None |
| A0A496SQR9 | 372-852 | None |
| A0A521VV52 | 72-756 | None |
| A0A521W2G9 | 308-1011 | None |
| A0A7V5BFM7 | 2-643 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.