DPCstruct | MC41717
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 140 ± 19 aa |
| Standard deviation of domain lengths | 19.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A640SE15 | 1-150 | MKGQGRPRGRQKRLAALFPSGGGSAGTAARTPFVVLIVVLLGSGLITLLLLNSALNQGSFELSKLEKKTDELTDEQQALQQEVDAYS… |
| A0A1R4GNJ3 | 19-162 | STVGANARALAPTSLPRSEPKQRTPLSLVPATKRNRRAGFAVFCFALLLAALVGVLVINVNVANSQYDIVSLRGQEQALSQENEALT… |
| A0A2S6GQQ7 | 194-348 | None |
| A0A3A3ZL27 | 53-200 | None |
| A0A7W7CII9 | 15-212 | None |
| G8SB83 | 156-287 | None |
| A0A7Z0D4Z7 | 1-146 | None |
| A0A2P7AHY1 | 1-124 | None |
| A0A372GJN6 | 47-179 | None |
| A0A562I3Y6 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.