DPCstruct | MC41715
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8FPF4 | 1-112 | MARLSRGLVMVMVIVAAIQLCSHQQAETTATATASLSWRGPCSVEARLKIEECMKEDTDADIDRCCPILHSLIDNSCSCWFHAMITD… |
| A0A1U7WKI7 | 30-129 | AEEEMKQLEEVVETSKAMDNKSSCNQQLQEQPTCCAKDKEKIKNCMLNTASIDQCCPTFSIMLGRNCDCYNYAKDLDNQALITLESY… |
| A0A1J6JSR4 | 106-202 | None |
| M1D5Q0 | 1-105 | None |
| M1D5G8 | 1-98 | None |
| A0A1U7W3Z5 | 118-219 | None |
| A0A1S3X6E2 | 64-152 | None |
| A0A2G3AM68 | 61-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.