DPCstruct | MC41710
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 155 ± 25 aa |
| Standard deviation of domain lengths | 24.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05683 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1H7C8 | 470-637 | LECLSKYPISTLLLLTGKLVVARDTAHKKIVDQFINDNIPIPDYFKKHPIYYAGPAKKPDNYASGSFGPTTAGRMDAYAEVLMKNKS… |
| A0A654HEF7 | 622-782 | ELSKHPVRTRVSLTGTLVVGRDIAHAKIKERLDAGEPMPEYMKNHPIYYAGPAKTPEGYASGSFGPTTAGRMDSYVDLFQSKGGSMI… |
| A0A6J4H111 | 380-558 | None |
| A0A7V3M2Q8 | 1-133 | None |
| B0EPH7 | 325-505 | None |
| A0A843DD06 | 10-160 | None |
| A0A377C054 | 3-181 | None |
| A0A5E6NV32 | 70-224 | None |
| A0A7C3XV54 | 1-116 | None |
| A0A2V6U2H3 | 66-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.