DPCstruct | MC41706
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 578 ± 65 aa |
| Standard deviation of domain lengths | 65.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2ZV17 | 320-920 | LLIKNDELSELLDILHFLSQIKVDAVIIQDWGVYYFLKTHFPSLSIHASTQMGIHNSVGGNHLKKLGFERVILARELNMKELRQISK… |
| A0A7Y9K716 | 7-641 | QLELLAPARDADIGIEAINHGADAVYIGGPAFGARAGAGNDIRDIARLVRHAHRFNSRIFITLNTILRDDELEDARQMAWQVYEAGA… |
| A0A7C6SBR4 | 66-746 | None |
| A0A7C3LAD0 | 1-566 | None |
| A0A7X8HDX3 | 1-513 | None |
| A0A316LWB2 | 147-761 | None |
| A0A350IFX9 | 4-559 | None |
| A0A353EZ21 | 2-546 | None |
| A0A645AIC9 | 1-644 | None |
| A0A521IGI9 | 66-713 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.