DPCstruct | MC41702
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 54 ± 2 aa |
| Standard deviation of domain lengths | 1.95 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 54.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D1KNA8 | 18-70 | IAVPQPARASDWGCQVVLCLATPGSPTTYPACVPPITKLWQHLAIGGVFPSCI |
| A0A7W6LVH2 | 18-67 | APAPALASDFGCQVLLCLSNPGGPTQYQQCVPPISKLWRQLALGKPFPSC |
| A0A2T4HSF3 | 19-70 | None |
| A0A2P7BUH7 | 20-74 | None |
| A0A2G8TAD2 | 1-55 | None |
| A0A1D8X6W2 | 372-425 | None |
| A0A0F0DLL3 | 2-55 | None |
| A0A6P2ZQP1 | 21-72 | None |
| A0A6G8NM36 | 32-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.