DPCstruct | MC417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 376 ± 68 aa |
| Standard deviation of domain lengths | 68.28 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162XFX8 | 12-456 | WTALFLFLSCAVVPMVVLGYFTPEPSFAFGTWPPFYNVFATKTMSCDNRDIDYYPVNSTITGIEGLFVLDQTWGRFAFSTVKTIDAA… |
| A0A1Y2X4B4 | 23-406 | SICMVDGTFVVNQNDYSLWGISHFFNIGIGFGNFTFAEAKIIDISWDIVVGRGGQALMAFLSWNVFADYVTTSMEFAPVTFTVFSFI… |
| A0A517LKC9 | 1-258 | None |
| A0A420U9V6 | 3-328 | None |
| A0A6A6A051 | 23-320 | None |
| A0A3N4KXR5 | 26-368 | None |
| A0A6A5S4K8 | 4-304 | None |
| R1GNI6 | 4-364 | None |
| A0A177DBR4 | 37-399 | None |
| A0A093YEY8 | 42-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.