DPCstruct | MC41698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 12.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7D7F9 | 1-112 | MEWVFGPEGPITRDIIARQGYALRVRCETEGTDRKVFIGTVTEKKLTDWAPLHLCRMTTEGIVTPLLEELRANGTVRAGGLRNTPFP… |
| A0A2N4A6A4 | 76-156 | VPVDRDTLIDRWCVHRIRLDSEGAARRVKIGTEACARPTEWFGLDDCAMTERGLSTPAVERIIESRRTPPPARWSPGKVKK |
| A0A4D4NBA2 | 160-243 | None |
| A0A7K2H0E3 | 115-228 | None |
| A0A1Q5KW27 | 5-105 | None |
| A0A101RRE4 | 71-152 | None |
| A0A6G3QHX4 | 36-119 | None |
| A0A4V3FF25 | 69-151 | None |
| A0A6I6SFD9 | 136-231 | None |
| A0A7X1J9R8 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.