DPCstruct | MC41697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 115 ± 28 aa |
| Standard deviation of domain lengths | 28.48 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 72.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0511 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8IVF3 | 18-110 | STQKYDSVRFRSQQPRPDGPPPAGYTCNRCRVSGQHWARQCPGLTDCSGNRLDPARVQRPSGIPSDFLQILPTKVDGAYLMKDGRYA… |
| A0A1I7YGJ5 | 1-124 | MSEEERLQVVLRQSEAIYAQAYLKPLPEKPRFFPNIVYRPNNVVPADYVCNICSKPGHWIQGCPLKKYKKANGILASELMPCASDDP… |
| A0A2H9TIL9 | 204-326 | None |
| E7EXE9 | 123-226 | None |
| A0A0C2YUN9 | 10-125 | None |
| A0A5N4CVW0 | 126-221 | None |
| A0A2I0IC28 | 22-156 | None |
| A0A367KXH9 | 30-160 | None |
| A0A0N1J5G0 | 86-267 | None |
| A0A1Y2G645 | 91-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.