DPCstruct | MC41696
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 245 ± 36 aa |
| Standard deviation of domain lengths | 36.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.19 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | PF13874- CL0647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8IUK4 | 1-242 | FGFGKPAGAAVSSAASFGAGFGAAGKFTLGAFGQTAAAPAGVATSAAASAASSVAFFASLTQPALFPDERDSVLARWNQLQAQWGAG… |
| A0A673LWQ0 | 2-188 | CVCVFAGGLFNQQASQSSQLFNTASALSAPSVLSDERDSILARWNQLQAFWGVGKGYYSSSTPPVEFSQENPFCRFKAVGYSCVPDV… |
| A0A817YMT9 | 469-781 | None |
| A0A6J2UGN5 | 26-285 | None |
| A0A2J7PC90 | 138-377 | None |
| A0A3B5KXF7 | 2-230 | None |
| A0A1I8I9U2 | 17-239 | None |
| A0A182EJD3 | 53-294 | None |
| A0A1I8G035 | 2-185 | None |
| A0A2H1CF27 | 94-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.