DPCstruct | MC41694
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 601 ± 70 aa |
| Standard deviation of domain lengths | 70.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8IP95 | 17-544 | FSVSHVVVFNCIGTQVNPAVTRTLQLVSQLRQQLLGQLCQAYRSFPVPRDWTLNGRTSCPAVLFHFQLSPGNLTKQLIDGGHERALA… |
| A0A7E5VFZ6 | 148-831 | RTEQIARSTAALVSINATGAWETHGRTCCPRLLFHFRRAPTPLKKNPAALKRLEHSVEDQLYFILRKSRIITNVCAKSLFAIPKNEE… |
| A0A4Z2AY22 | 32-589 | None |
| F4PR26 | 222-883 | None |
| A0A2A6CCN2 | 108-727 | None |
| A0A3B5L298 | 13-721 | None |
| A0A7I0Z5X2 | 1-630 | None |
| A0A7J7KB60 | 104-750 | None |
| A0A2P6U1N8 | 90-600 | None |
| A0A2P6V5L5 | 95-664 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.