DPCstruct | MC41690
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 189 ± 43 aa |
| Standard deviation of domain lengths | 42.85 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8IBC1 | 316-482 | IQLRPGEDAELASMILDCCAQLRTYEKFYGLMAQRFCQLDRAYVQHYERIFTEQYNTIHRLETMKLRNVARFFAHLLHTDSISWGVM… |
| A0A2G9FYC7 | 16-207 | RAVFCVIMSADDYIDAFEKILRLDLPGKQDREIMRVLVECCLQEKVFNKYYCVLASKLCSYDKNHKFTLQYCLWDHFKELESMSLIR… |
| A0A653BJM5 | 135-280 | None |
| A0A194QQM4 | 768-976 | None |
| A0A1J4MIR4 | 507-712 | None |
| A2DQ16 | 269-479 | None |
| U7Q7R4 | 201-443 | None |
| M4CAT1 | 160-324 | None |
| A0A4Q7K6Z9 | 916-1085 | None |
| A0A5B8MTM4 | 377-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.