DPCstruct | MC4169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 2.53 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 38.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A525W4R9 | 1-78 | MKAIAPADIIPHQEYERQREAFRANIIALKQRRRMSVGPCITMVFENRATVQFQIQEMIRVERIFDPVKVQDELDVYN |
| A0A7C3U4U2 | 79-161 | VRPVYLSDIKDLVQYERERPAFQRHVIETRKRRRVALGDRISISFENRDTVLYQIQEMMRAERIVDQDRIQEEIDTYNPLVPG |
| A6G394 | 10-88 | None |
| A0A7V8W8C2 | 116-197 | None |
| A0A534PAG4 | 160-236 | None |
| A0A328ZZR5 | 461-539 | None |
| A0A3M2DX93 | 61-143 | None |
| A0A1G1ASM4 | 1-84 | None |
| A0A2E9GPY6 | 158-235 | None |
| A0A534STS9 | 39-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.