DPCstruct | MC41689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 205 ± 31 aa |
| Standard deviation of domain lengths | 30.55 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8IB89 | 1-209 | MRVGRLKITELLKFLVACGIGYTLRVLIESSNYKYSSSLAGERLNAVNSISESETVEQTRKRLCGDIHEQLKMPYRPGHENETIEYR… |
| A0A6P7MBN3 | 161-343 | HPVSEPNLMYRLHKRFSQIELEWTYLQIQQLQMQINNLSDLTPEGKAGVTWPIGINPPFKPKVRFEVINWEYFTEEHIYTCVDSSPK… |
| A0A834XP59 | 315-585 | None |
| A0A6P6QL64 | 43-263 | None |
| A0A7M6DP24 | 71-253 | None |
| A0A183J8P7 | 3-205 | None |
| A0A3B3XHI2 | 36-282 | None |
| A0A5E4AW48 | 322-501 | None |
| A0A835GMX4 | 1-236 | None |
| A0A5J5CVN1 | 128-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.