DPCstruct | MC41688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8I9G7 | 75-189 | RRKWRCSCRNSRGDLWLVSRYSTGWLCGLHADFAALSACVPGQLAALDSDFERPRRLRYVTMLRRPADRFLSEWQHARRGATWRKSQ… |
| A0A2A2LMK5 | 44-166 | DKPCQCTKGKKRCNCKRPNNQNEIWLFSRYSTGWLCGLHSDYTELFVNGCVNEALDKKEGFHQKRRYYYTTFLREPISRFISEYRHV… |
| A0A7F8R9P9 | 250-359 | None |
| A0A4W6DIT4 | 116-220 | None |
| A0A182F749 | 3-113 | None |
| A0A4S2LA09 | 1-104 | None |
| A0A085M5N2 | 145-273 | None |
| A0A3P6RVF1 | 151-285 | None |
| A0A833SAY1 | 194-311 | None |
| A0A6J8EXR5 | 11-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.