DPCstruct | MC41684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 271 ± 33 aa |
| Standard deviation of domain lengths | 33.20 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8I0I3 | 52-345 | DCQISELELIQYLSMDLTRLSRLIYEVCTKFKGLKKNAYLALSNFLERAIWNWLENFPQEFDELQTKPNEELAERCERLFDMLTPLC… |
| A0A6J8D4H6 | 92-361 | SAKLTSLSSASDDPDLSDLELIQHINVDVLRLIKLFNDINSKFKFLKNKHVITLAYNLEKAIWMWMDNYPEEFTELQKKPNDELQDC… |
| A0A2G8KZB2 | 16-238 | None |
| A0A6A7FZG8 | 137-473 | None |
| I1CU11 | 173-465 | None |
| A0A0C4FD63 | 70-334 | None |
| T0MGP4 | 30-268 | None |
| F4RT96 | 2-262 | None |
| A0A164XEF1 | 2-249 | None |
| U9TGH7 | 2-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.