DPCstruct | MC4168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.77 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A532BWH9 | 3-88 | TTAGYGPRYLHSTGQLHKGGPKSGVFLQLVDRMIPDLGIPGKPFSFRTLAQAQAAGDIQALKAHDQQGIVLPLGKNPIATIQTLTK |
| A0A7C2ZDL3 | 589-672 | GFGPRYLHSIGQLFKGGPPQGRFLMLTTEHSEDALIPEAGYSFAQLELAQALGDFEALARRGRPVLRLHFRQGAEAGLSVLQAA |
| A0A645HFW9 | 53-122 | None |
| A0A1C4X8S8 | 1-84 | None |
| A0A7Y5WYJ4 | 1-72 | None |
| A0A535J6T2 | 206-284 | None |
| A0A6J6DAL1 | 8-98 | None |
| A0A359EHI0 | 42-128 | None |
| A0A7V3H4U5 | 115-195 | None |
| A0A7W1UPR1 | 315-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.