DPCstruct | MC41678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K0E3V8 | 2-123 | PCCLETIGKNSCEEMLRTKPYIFEEKCEKDPDFAIIQCCHTCQTNVKEYGLKIFKKGKKSKECFDRHEKKFCLQFLYRLGAWSGMKN… |
| A0A1I7ZHN7 | 6-127 | VATLPCCRDRLGEIACQAIRKTNPAHFEKRCLGDHDFHMSCCKECRNYIENHKIHPENARSLFRAPQFCRDKRSLAFCRRFKTNGLG… |
| A0A0K0E0D0 | 14-146 | None |
| Q19740 | 83-227 | None |
| A0A0N4WDX5 | 9-123 | None |
| A0A1I7YW17 | 44-169 | None |
| A0A0N4ZXI8 | 115-279 | None |
| A0A0N4VJQ4 | 33-172 | None |
| A0A2A6CZQ8 | 253-400 | None |
| A0A2A6D0I4 | 62-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.