DPCstruct | MC4167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5BH65 | 3-148 | QASASAALGAVAAALLAGCAGETASVAIDGSARALTVSVRRNLPWEREYEVEAVMSALPACQRRSRLEPVPGGEFRLELHRAPDGVY… |
| A0A532BV62 | 1-121 | MPASVEFSADQVRLTITRTATSPFLSRHDLLLTMAGPGSCSLYVDLFPNTGYASRRNLYQAGAGVLYVVGQFDARVIDVPHCTVTLA… |
| M4ZFQ4 | 1-157 | None |
| A0A7W2EK60 | 2-141 | None |
| D9QHB4 | 15-136 | None |
| A0A1V2H5Q6 | 5-162 | None |
| A0A0S7YFR7 | 33-155 | None |
| A0A6M1M7B9 | 26-179 | None |
| A0A2V8SM19 | 9-156 | None |
| A0A7X0JB90 | 17-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.