DPCstruct | MC41668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 13 aa |
| Standard deviation of domain lengths | 13.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 51.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165PDY0 | 28-112 | LHAKLRQDPRFNQPAPALWKRILLLVFFFGLVWLGFNLRLQGNSDPKVVHAQRYSKDYKFRPAASPVISERLKDGRVRVRGAQPT |
| A0A4V2MVY1 | 34-115 | RDPRFNPPAPSLWKRVALLITIVALFYIALKMRIGLLQQPEPPVVHAQRYSKEYKFRPAASPIVTERLKDGRVRVRGAHPVA |
| A0A1B7N3C1 | 4-84 | None |
| A0A409VQJ0 | 294-381 | None |
| A0A225Y351 | 103-178 | None |
| A0A0C3B0T1 | 1-97 | None |
| F8NI64 | 1-69 | None |
| A0A0C3BMS2 | 54-139 | None |
| A0A0W0EZ62 | 12-120 | None |
| A0A0C2X672 | 21-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.