DPCstruct | MC41667
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 18.09 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 35.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4LG94 | 9-166 | LFTFINYQEQMIRTLLTLLIGKSMFDKPKDNLPVNKPYRKLQVDDLPIIEIPEKLNYRNLLAEYQEKHGKSLKPVQRRKNAKVTVPK… |
| A0A3P6JN85 | 2-129 | LLEYYKYKYNKILKPVQRYNGKPIPESIIRPKCGSPYDYICDNNGNKGQFQCKICGLTFKENNNATKPLVFKCPYCGHTLIVQKERK… |
| A0A097AQC3 | 1-185 | None |
| A0A1G9U3C1 | 20-150 | None |
| A0A1V5BYW6 | 1-126 | None |
| A0A6C2U869 | 19-180 | None |
| A0A1V6BW05 | 6-152 | None |
| A0A1M6MSE7 | 465-606 | None |
| R5KU21 | 42-175 | None |
| A0A1I3AXJ5 | 10-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.