DPCstruct | MC41664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.61 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 52.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K8AU75 | 124-197 | GGVVELSNLTRQRRLMALMPVEEVWGVGRRIARKLEAMGIKNALQLCDTDIRFIRKHFNVVLERTVRELRGEPC |
| A0A8B4PPG2 | 161-233 | GVVDLSLPARQRKLLEKVAVGEIWGVGRRIAKKLNDMGITTALQLAETPAPLIRKHFSVVMERTVRELRGEPC |
| A0A1V4G215 | 1-77 | None |
| A0A4P1AXX0 | 56-126 | None |
| A0A6A5L097 | 110-183 | None |
| A0A6A5KVB5 | 359-435 | None |
| A0A506NQQ5 | 82-166 | None |
| A0A6G6AJC4 | 105-175 | None |
| A0A0A7S183 | 109-179 | None |
| A0A4U9CXR0 | 76-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.