DPCstruct | MC41663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 337 ± 86 aa |
| Standard deviation of domain lengths | 86.30 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 20.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6H3B9 | 37-322 | GQETQKARMDLVMGGVKGETYLYWKENELFQLPVSFDYAQNKWIVSPGYDTVMASYDRAVNVRCLECHTTYAVTEPGKLPSFGGEVI… |
| A0A1L8D0N1 | 214-677 | PVVLPAETAYAGSKTCQSCHGFSSFSSSWHTNMVKKPADFGNMIPWDSNSKFKASDVKYILNAPGELRFVGKDYMFLPLNFNKELNY… |
| A0A2E1H305 | 84-379 | None |
| A0A431WDJ1 | 129-576 | None |
| A0A2V6GRK5 | 3-246 | None |
| Q01VN2 | 30-282 | None |
| A0A355F8F9 | 169-605 | None |
| A0A7Y2JQ83 | 2-354 | None |
| A0A7W7Z976 | 7-203 | None |
| A0A2V7SDB9 | 39-470 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.