DPCstruct | MC41662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A499UZN3 | 49-140 | PAVTVQFGLYDVVDGERRLCGVAVFGVPVSTAVLTKPLPELRPYTESLVCSRFVLLDECPANSESWFLANCLKRLLARGVHGVVSFA… |
| A0A1H7D5M2 | 50-137 | TYPAAQVAVGLFDRSGALEGVAVFAVPTTGAVISRHTGFDDPARGCVLARLILTDAVPQNGESFFVARAFRHLRRERPGIEAVVSYSD |
| V9Z5B5 | 41-141 | None |
| A0A2A2K4T6 | 152-243 | None |
| G2G450 | 70-163 | None |
| A0A1Y2KJU1 | 21-119 | None |
| A0A1I6B0I9 | 52-144 | None |
| A0A1E5PHP5 | 1-105 | None |
| A0A7W3NHY2 | 70-165 | None |
| A0A7R6TAD0 | 74-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.