DPCstruct | MC4166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 2.92 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 70.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1P779 | 56-118 | MGFWPTYPPVEVRLPAELTRHQDHFAKFYLAKHSGRKLQWQATLGHCVLRAHFAQGNKELQVS |
| A0A251VRC1 | 1-54 | MDVRLLHELNVYQDIFKEFYLSKYSGRRLMWQNSLGHCVLKTEFAKGKKELDVS |
| A0A7J8MVP3 | 1-56 | None |
| W4H1Q0 | 512-573 | None |
| A0A843W1G8 | 98-159 | None |
| A0A1S3QZ50 | 32-94 | None |
| A0A6N2LLN1 | 200-260 | None |
| A0A3L7H3C7 | 1-64 | None |
| A0A6N2MLS6 | 371-433 | None |
| A0A7J0DUY9 | 555-616 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.