DPCstruct | MC41659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 165 ± 27 aa |
| Standard deviation of domain lengths | 26.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A286UTM7 | 70-204 | GPVVDPTAANGILDFLANKDAIDDRKGFFTTALSTITKLPPGKLQDTLNNEAIAVLYNTLTHPPPTYIGPSYRFRSADGSGNNPIIP… |
| A0A2K0VU99 | 1-170 | MAANKSEAGNARDVQTNLADLLNEVRRDILSQAGRIGPDLRILHGAAETALAGGIVDDRKYLVENIMQLAASLPNGSRARDDLNAAF… |
| A0A428UDC4 | 74-216 | None |
| A0A2N5TZ66 | 47-240 | None |
| M5CGA8 | 1-133 | None |
| A0A409YBA5 | 53-201 | None |
| A0A2S7PDX2 | 63-265 | None |
| A0A0N1HTI0 | 21-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.