DPCstruct | MC41657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 128 ± 12 aa |
| Standard deviation of domain lengths | 11.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K0ULX2 | 1-132 | MIGNPLDLPTIIAAPSFVGLGVITSNVYIGETSEWYLNQNNFLRSVRNFIIDVRPTPANAQVCAIHWQVAQGTSLENIYFYMTKFKD… |
| A0A0U5CRW2 | 1-125 | MIGDAVDLPVLKASADFTGMAVVDADPYTDDGSNWYTNQNNFFRAIRNFVIDLTDMPQSVGAGIHWQVGQATSLQNIRFEMIKGGDD… |
| A0A081CE03 | 284-412 | None |
| A0A0B4HTF0 | 12-120 | None |
| A0A194X730 | 81-203 | None |
| A0A1V6SYX6 | 61-155 | None |
| J4UJ86 | 80-196 | None |
| A0A2P6MUI7 | 485-613 | None |
| A0A2P6MN78 | 330-482 | None |
| U7Q190 | 280-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.