DPCstruct | MC4165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 74.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5KUI1 | 608-680 | YLGIAPIVEALQAGAQVIITGRVADPALVLAPLVHEFGWAADDWDKLGQGTVIGHLLECAGQITGGYFADPGK |
| A0A251VR74 | 1-80 | MYLGAAPIVGFLEKYNPDVVITSRVADASLFLAPMVYELGWNWDDFSLLAQGSLAGHLLECGCQLTGGYFMHPGQCGSHE |
| A0A287X0U7 | 1-108 | None |
| A0A287X0V7 | 240-339 | None |
| A0A7I4EMV2 | 132-239 | None |
| A0A0A0L7H7 | 731-804 | None |
| A0A453S599 | 94-192 | None |
| A0A4D6MP20 | 651-723 | None |
| A0A453S4A3 | 165-265 | None |
| A0A287X0V2 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.