DPCstruct | MC41647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 106 ± 13 aa |
| Standard deviation of domain lengths | 13.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P9K210 | 1-108 | MNTSSQIRLLLWKNWTLRKRQKKRFLVEIFWPVLLFVGLVWLRKANPLYQQHECHFPNKAMPSAGILPWIQGIFCNVNNPCFRHPTG… |
| A0A6I9NA89 | 3-93 | FFQKLGLLLWKNITYRRRNKIQLIIELLWPLFLFVILIAVRHSHPPYKQSQCHFPNKALPSAGTLPWIQGIICNINNPCFQSPTPGE… |
| A0A183B3D3 | 44-149 | None |
| A0A2K6BW79 | 1-117 | None |
| A0A183TIQ3 | 131-236 | None |
| A0A0R3U8H0 | 36-128 | None |
| A0A813WHY3 | 2-113 | None |
| A0A3Q1H0U3 | 1-98 | None |
| A0A6F9CA74 | 8-120 | None |
| V3ZSV3 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.