DPCstruct | MC41638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01924 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377D7T2 | 1-89 | MGRIDTCVEIASHPEVIFCTFGDAMRVPGKQGSLLQAKARGADVRIVYSPMDALKLAQENPTRKVVFFGLGFETHHADDGHHSATGE… |
| A0A4Y7X780 | 61-131 | IDAAIALSKMPEVILVTFGDMMHVPGSNRMSLHKARAYGARSEVVYSPRDALQIASDNSNSKVVFFATGFE |
| A0A0J7KIL1 | 56-121 | None |
| A0A4P1APJ5 | 40-100 | None |
| A0A5E6NQW7 | 1-80 | None |
| A0A2G6FLM3 | 128-191 | None |
| A0A451A9P2 | 65-134 | None |
| A0A376TU74 | 77-144 | None |
| A0A833GXR1 | 1-72 | None |
| A0A6A9T187 | 209-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.