DPCstruct | MC41630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 9.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 43.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377C8K4 | 9-93 | PENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQKPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQ |
| A0A377Z8E9 | 7-100 | MMDKVPDSIPKDERIWFALAAYNMGYAHMLDAMALTRKQKGNPNSWADVKLRLPLLSQKPYYSKLKYGYARGHEAYAYVENIRKYQI… |
| A0A128ERW7 | 140-224 | None |
| A0A849F0P5 | 2-80 | None |
| A0A7C6FBR9 | 104-213 | None |
| A0A352IA28 | 294-386 | None |
| A0A352KPJ9 | 192-287 | None |
| I8TAQ4 | 154-243 | None |
| A0A377I6U9 | 34-133 | None |
| A0A377AXH0 | 2-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.