DPCstruct | MC4163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 154 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2N9M4 | 6-157 | PQNLEEYSTSSTTIKFDRPLLLLRGPIPAGTSDDPSSSPYILAFKDLPSWAAAYKSYESKIISQCEEGARIGCAITASNKCKPPWWQ… |
| A0A251VNL2 | 2-191 | SSTDDYSPTETLITFNNPIPLLRHPTPSTTDDSLILCFPNPKSFATAYNQCESNIINHCTSGARIGCSVSASKNCAPPWWKTLAGGG… |
| A0A199VXC2 | 18-174 | None |
| A0A833RLL2 | 10-183 | None |
| A0A2P5X796 | 1-160 | None |
| A0A383WPG0 | 2-139 | None |
| A0A7I4EI11 | 18-177 | None |
| A0A1U8PKH4 | 141-322 | None |
| A0A0K9QN85 | 5-156 | None |
| A0A2V0PNY1 | 8-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.