DPCstruct | MC41628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 13.38 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377C414 | 1-112 | MTNWHQLTGWQAIDGFKEGEPAEAEIGVAVIDCGGTLRCGIYPKRRIPTINIHSTGKSGPLAQYIVEDIYVSGVKEENITVVGDATP… |
| A0A1M6H257 | 52-117 | GMEAVNGFRYRVQEEEMAVAVIDCGGSLRSGVYPRKGIPTINLVPTGKSGPLSEFMTANMYVSGVS |
| A0A2X1QSL1 | 230-327 | None |
| R2XH40 | 45-123 | None |
| E2SMN4 | 80-171 | None |
| A0A3S4GGE1 | 1-96 | None |
| A0A377VWX7 | 43-141 | None |
| A0A7V8IJB7 | 44-127 | None |
| A0A2X2WVC0 | 43-147 | None |
| A0A7C5E396 | 81-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.