DPCstruct | MC41626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 11.98 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4EB35 | 121-254 | NALDATKTAGIFMAHAAGGTIGAALGTVMARGVNFIIPVGIEKTIPYSITEAAKRVGKERFYKSVGKPVGLMPVHGTVITEVEALEI… |
| A0A7G9ZBZ0 | 7-147 | NALDATKTAGIFMAHAAGGTIGAAVGIVMARGVNFIIPVGIEKTIPYSITEAAKRVGQGRFYKSVGKPVGLMPVHGTVITEVEALKI… |
| A0A1G1CPZ9 | 136-288 | None |
| A0A7V6VUK7 | 10-131 | None |
| A0A7V6KWF1 | 19-141 | None |
| A0A1T5L2K9 | 107-250 | None |
| A0A259UDR1 | 47-188 | None |
| A0A4V3HGX5 | 108-245 | None |
| A0A3N5WE94 | 45-193 | None |
| A0A7C7K6U7 | 14-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.